PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6KG248200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 276aa    MW: 30095.3 Da    PI: 4.6324
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6KG248200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.37.4e-2079132356
                          --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          k++++t+eq++ Le+ Fe+++++  e+++eLA++lg+  rqV vWFqNrRa++k
  Pavir.6KG248200.1.p  79 KKRRLTAEQVQLLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWK 132
                          56789************************************************9 PP

2HD-ZIP_I/II132.61.4e-4278169192
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          ekkrrl++eqv+lLE+sFeee+kLeperK+elar+Lg+ prqvavWFqnrRAR+ktkqlE+dy++Lk+aydal+++++ L +++++Lr++
  Pavir.6KG248200.1.p  78 EKKRRLTAEQVQLLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKTKQLETDYDRLKAAYDALAADHQGLLADNDSLRAQ 167
                          69**************************************************************************************99 PP

          HD-ZIP_I/II  91 lk 92 
                          + 
  Pavir.6KG248200.1.p 168 VI 169
                          86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007118.20474134IPR001356Homeobox domain
SMARTSM003896.9E-1977138IPR001356Homeobox domain
SuperFamilySSF466896.27E-1978143IPR009057Homeodomain-like
PfamPF000463.9E-1779132IPR001356Homeobox domain
CDDcd000862.63E-1879135No hitNo description
Gene3DG3DSA:1.10.10.601.8E-2180141IPR009057Homeodomain-like
PRINTSPR000314.4E-6105114IPR000047Helix-turn-helix motif
PROSITE patternPS000270109132IPR017970Homeobox, conserved site
PRINTSPR000314.4E-6114130IPR000047Helix-turn-helix motif
PfamPF021834.7E-16134176IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MDPGRVGVDS GGARRGGGGG AQMLLFGGGG SANSNGFIRG IPMAVLGMDD AARVGKRPFF  60
TTHEELLEEE YYDEQAPEKK RRLTAEQVQL LERSFEEENK LEPERKTELA RRLGMAPRQV  120
AVWFQNRRAR WKTKQLETDY DRLKAAYDAL AADHQGLLAD NDSLRAQVIS LTEQLQGKDT  180
SPSATITAQE VDQLDEHTAA SGTEKLLVQL KHDHLSSGDC TGHGALSSEE EDGGVISDEV  240
CSFDLPDALF AAAGVTHHGA EEAQLCSWNS WLWNN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126134RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.78830.0callus| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973433.11e-161PREDICTED: homeobox-leucine zipper protein HOX5-like
SwissprotQ6ZA741e-110HOX5_ORYSJ; Homeobox-leucine zipper protein HOX5
TrEMBLK3YJ091e-161K3YJ09_SETIT; Uncharacterized protein
STRINGSi014228m1e-161(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26093887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.13e-54homeobox 1